Protein Info for IAI46_08450 in Serratia liquefaciens MT49

Annotation: DUF2867 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 242 to 261 (20 residues), see Phobius details amino acids 405 to 421 (17 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details PF01370: Epimerase" amino acids 6 to 113 (108 residues), 43 bits, see alignment E=9.2e-15 PF05368: NmrA" amino acids 6 to 141 (136 residues), 28.4 bits, see alignment E=2.8e-10 PF01073: 3Beta_HSD" amino acids 7 to 111 (105 residues), 24.1 bits, see alignment E=4.3e-09 PF13460: NAD_binding_10" amino acids 10 to 144 (135 residues), 53 bits, see alignment E=1e-17 PF11066: DUF2867" amino acids 332 to 463 (132 residues), 57.5 bits, see alignment E=5e-19

Best Hits

Swiss-Prot: 63% identical to YBJT_ECOLI: Putative NAD(P)-binding protein YbjT (ybjT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_1661)

Predicted SEED Role

"FIG01055587: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>IAI46_08450 DUF2867 domain-containing protein (Serratia liquefaciens MT49)
MTPQRVLVLGASGYIGQNLIPHLIEQGHSITAAARRLEWLQEQHWPQVNCQYVDVYQPET
LTAALWEIDAVYYLIHGMGDGDDFIEKERQAAENLRDALRNASVKQVIFLGALQPEGESS
PHLVARKLTGEILRQSGVPVTELRASIIVGPGSAAFEIMRDMVYNLPVLTPPRWVRSKSS
PVALENLLVYLADLLAHPAEENRIFDVAGPEYISYQTMFERFIAISGKKRWLIPIPLPTR
FISVWFISMITSVPTSIANALIQGLNHDLPADGKPLQALIPQTLQTFDQAVAATLRREEE
VVDSADWGYDPEARARWRPGYGFYPKQAGCSLETQASSQALWHTVQQLGGKEGYFYANIL
WKIRARMDDMIGNRVVYGRPQRETLAIGDLVDGWKVITIKPLRQLALLFGMKAPGLGRLV
FTIKDHGDHRTLDVRAWWHPAGFSGLLYWFAMMPAHLFIFRGMARRIARLAEENPRNMS