Protein Info for IAI46_08420 in Serratia liquefaciens MT49

Annotation: arginine ABC transporter ATP-binding protein ArtP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 170 (152 residues), 138.7 bits, E=2e-44
• PF13304: AAA_21
  • amino acids 141 to 199 (59 residues), 28.6 bits, E=1.4e-10

Best Hits

Swiss-Prot: 86% identical to ARTP_SHIFL: Arginine transport ATP-binding protein ArtP (artP) from Shigella flexneri

KEGG orthology group: K10000, arginine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to spe:Spro_1656)

MetaCyc: 86% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, ATP-binding protein ArtP" in subsystem Arginine and Ornithine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (242 amino acids)

>IAI46_08420 arginine ABC transporter ATP-binding protein ArtP (Serratia liquefaciens MT49)
MSIQLNGINCYYGAHQALFDITLDCPAGETLVLLGPSGAGKSSLLRVLNLLEMPRSGQLQ
IAGNQFDFKQAPGEKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKAQAME
RADKLLKRLRLTDFADRFPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIRELAGTGITQVIVTHEVEVARKTASRVVYMENGHVVEQGDASHFAQPQTTEFANYL
SH