Protein Info for IAI46_08390 in Serratia liquefaciens MT49

Annotation: YbjO family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details PF10767: YbjO_DH-like" amino acids 17 to 156 (140 residues), 203.2 bits, see alignment E=8.8e-65

Best Hits

Swiss-Prot: 45% identical to YBJO_ECOL6: Inner membrane protein YbjO (ybjO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 92% identity to srs:SerAS12_1627)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>IAI46_08390 YbjO family protein (Serratia liquefaciens MT49)
MADMLNSRQGMRTTSDAPVPVMVAGTAMVAIKCISVLLLLGELGVDGAQEFVSTSAQAWD
STLIFLAGLVLLCLQISCGFAVMRGRNWGRWVYVACQCAVVGYLLLATIGSFLPEVFTVE
GETSGQILHVLILQKIPDVVILALLFVPATSRRYFAARN