Protein Info for IAI46_08305 in Serratia liquefaciens MT49

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00126: deoxyribose-phosphate aldolase
  • amino acids 8 to 216 (209 residues), 275.5 bits, E=1.2e-86
• PF01791: DeoC
  • amino acids 11 to 215 (205 residues), 67.1 bits, E=9.4e-23

Best Hits

Swiss-Prot: 86% identical to DEOC_YERE8: Deoxyribose-phosphate aldolase (deoC) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 99% identity to srs:SerAS12_1605)

MetaCyc: 85% identical to deoxyribose-phosphate aldolase (Yersinia sp. EA015)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

• superpathway of purine deoxyribonucleosides degradation (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (3/3 steps found)
• 2-deoxy-D-ribose degradation I (3/3 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.4

Use Curated BLAST to search for 4.1.2.4

Protein Sequence (226 amino acids)

>IAI46_08305 deoxyribose-phosphate aldolase (Serratia liquefaciens MT49)
MTTENIDYARYVDHTLLAMDATEEQIAKLCEEAQQHNFYAVCVNSGYVPLAAHLLQESEV
KICSVIGFPLGAGLTVAKAFEAKAAIAAGAQEIDMVINVGWLKSGLLDEVKADIAAVREV
CAAIPLKVILETCLLSDAQIVQVCEMCRELDVAFVKTSTGFSTGGAREEHVKLMRATVGS
EMGVKASGAVRDRATAEKMIKAGATRIGTSSGVAIVSGDQAAAGSY