Protein Info for IAI46_08280 in Serratia liquefaciens MT49

Annotation: cystathionine beta-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF00291: PALP" amino acids 9 to 301 (293 residues), 249 bits, see alignment E=6.8e-78 PF00571: CBS" amino acids 344 to 388 (45 residues), 29.4 bits, see alignment 8e-11 amino acids 402 to 449 (48 residues), 28.6 bits, see alignment 1.5e-10

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 97% identity to spe:Spro_1627)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>IAI46_08280 cystathionine beta-synthase (Serratia liquefaciens MT49)
MAIPHSVIDMIGNTPMLELTQFDTGPCRLFVKLENQNPGGSIKDRVALSMIERAERDGSL
QPGGTIIEATAGNTGLGLALVAALKGYKLLLVVPDKMSREKIFHLRALGVEVVLTRSDVG
KGHPAYYQDYAKRLADEIPGAFYIDQFNNPANPAAHTRTTAPELWQQMEHQVDAIVVGVG
SGGTLGGLSHYFAEVSPQTEFVLADPAGSILADYLDNGQIGEAGSWLVEGIGEDFIPPLS
DFNQVRNAYRIGDAEAFTTARDLLRKEGVLAGSSTGTLLAAALRYCQAQTEPKRVVTFVC
DSGNKYLSKMYNDHWMLEQGLLSKPQHQDLRDLIAYRHDEGAAVSVAPEDTLAIVHARMR
LYDISQLPVLEGDRVVGLIDEWDLLNAVQADASHFSLPAARAMTHSVKTLQKEASYQDLL
ATFNHGHVAVVLDGERFLGLITRTDVLNAWRQKLR