Protein Info for IAI46_08080 in Serratia liquefaciens MT49

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 442 to 458 (17 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 23 to 464 (442 residues), 548 bits, see alignment E=2.5e-168 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 23 to 464 (442 residues), 477.4 bits, see alignment E=6e-147 PF13727: CoA_binding_3" amino acids 64 to 238 (175 residues), 102.7 bits, see alignment E=2.4e-33 PF02397: Bac_transf" amino acids 274 to 457 (184 residues), 232.3 bits, see alignment E=2.9e-73

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 64% identity to kpu:KP1_3705)

Predicted SEED Role

"Colanic acid biosynthsis UDP-glucose lipid carrier transferase WcaJ" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>IAI46_08080 undecaprenyl-phosphate glucose phosphotransferase (Serratia liquefaciens MT49)
MNGFRRGTLHTNASLTSMIQRFSDIFIIFAGLYLSCLISGADFIMQHWVMVLISIVIFQM
IGGITDFYRSWRGVRAGLEVQLILQNWSLSLLLTSGTVALVNSFNNEYSVYIQWYLLVSC
GLVISRSVIRLFLGYMRNIGFNTRNVAIMGAMPVGIRLAESLRDAHWMGFKVLGIYDNDN
SQLNTTIERRGDLCQLVEDAKSGRIDRVYIAMSMEQEKLIKDTVADLSDTTCSVMLIPDI
FTFNILQSRSEEINGVPVVSLFDTPMSGINQVIKRIEDIILSILILLFISPVLLLIAGMV
KFTSSGPVIFKQRRYGMDGKAIEVWKFRSMSVMEDGDKVVQATKGDARLTSVGAFLRRTS
LDELPQFINVLKGDMSIVGPRPHAVAHNEQYRKLINGYMLRHKMKPGITGWAQINGWRGE
TDTLEKMQKRVEFDLDYIRNWSVWLDIKIVFLTIFKGFINKSAY