Protein Info for IAI46_08065 in Serratia liquefaciens MT49

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF13439: Glyco_transf_4" amino acids 17 to 174 (158 residues), 66 bits, see alignment E=1.3e-21 PF13477: Glyco_trans_4_2" amino acids 52 to 149 (98 residues), 27.7 bits, see alignment E=9e-10 PF13579: Glyco_trans_4_4" amino acids 72 to 172 (101 residues), 47.5 bits, see alignment E=7.5e-16 PF00534: Glycos_transf_1" amino acids 188 to 318 (131 residues), 84.5 bits, see alignment E=2e-27 PF13692: Glyco_trans_1_4" amino acids 192 to 314 (123 residues), 73.9 bits, see alignment E=5.1e-24 PF20706: GT4-conflict" amino acids 255 to 315 (61 residues), 36.8 bits, see alignment E=7.3e-13

Best Hits

Predicted SEED Role

"Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.52)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.52

Use Curated BLAST to search for 2.4.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>IAI46_08065 glycosyltransferase (Serratia liquefaciens MT49)
MKKKVLHVAETVKGGVATVIRQLVQPNGEFDFYCLLPDSQYSEIGTFPESKLKKFTRSGR
NISSFISLAVNYIRIVRKEKPDVIHIHSTFAGVICRLLTPLIRMSCKPKIIYCPHAFSFL
MDTSEKKKRVYTWIEKILQKKTDVIICTSEYEKRVALGVGLDSNNLTVVYNGVEPPLPTG
DHVTPYQSDKINILFVGRFDYQKGFDLVKEIADRLDDGFLITVVGGNVHATESPPHHARI
SYKGWLTSIEIAPYFSYADVLLMPSRWESFGLVAVEAESYGLPVVASRCSSLPEVVCEGV
TGYLFTTNKASEAVEILNTRGKDDWASMKAACVDFYSANFTSDRMVSSTYHLYR