Protein Info for IAI46_08050 in Serratia liquefaciens MT49

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF13439: Glyco_transf_4" amino acids 15 to 207 (193 residues), 61 bits, see alignment E=3e-20 PF13579: Glyco_trans_4_4" amino acids 16 to 198 (183 residues), 50.1 bits, see alignment E=8.2e-17 PF00534: Glycos_transf_1" amino acids 217 to 335 (119 residues), 47.8 bits, see alignment E=2.5e-16 PF13692: Glyco_trans_1_4" amino acids 221 to 330 (110 residues), 45.8 bits, see alignment E=1.6e-15

Best Hits

Predicted SEED Role

"Uncharacterized 42.6 kDa protein in cps region (ORF8)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>IAI46_08050 glycosyltransferase family 4 protein (Serratia liquefaciens MT49)
MKIALINTLYAPYKIGGAEVSVQMLAESLQTVGHQVRVFCLHDGDKIKYDSINGVSIVYF
PLKNLYWPFQKQVAGKLQKAGWHLLDSYNPFMARMVRYELAAFGPEVVHTNNLSGFSVAV
WRVAKKLGARVVHTTRDYYLFHPNGTLFKHGQNMDVNSLAVTITSYFKKKASQHVDAFVG
ISKYISTLHQENGFARHALHTYIYNPVAAIAFVPSISDKVRIGFVGRLTVDKGFDEFCLL
AKQGLQNPQVEFYAAGRFNNDASGQRMKALATEVGVKLLGFIKIDEFMAQVDAVVLPTRW
NEPFGRAVAESAISGKVVYTTFSGGVTEIAAFYDNILELKDFSVSGAVKAVRDNNNKLRS
SFFESGKIASSYESVYRG