Protein Info for IAI46_07985 in Serratia liquefaciens MT49

Annotation: outer membrane assembly protein AsmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05170: AsmA" amino acids 2 to 179 (178 residues), 67.8 bits, see alignment E=9.1e-23 amino acids 242 to 505 (264 residues), 81 bits, see alignment E=9e-27 PF13502: AsmA_2" amino acids 354 to 536 (183 residues), 63 bits, see alignment E=3.3e-21

Best Hits

Swiss-Prot: 48% identical to ASMA_ECOLI: Protein AsmA (asmA) from Escherichia coli (strain K12)

KEGG orthology group: K07289, AsmA protein (inferred from 89% identity to spe:Spro_1578)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>IAI46_07985 outer membrane assembly protein AsmA (Serratia liquefaciens MT49)
MRRLLTTLVILLVVLVAGMSALVLLVNPNDFRAYMVTKVEQKSGYHLTLDGELRWHIWPQ
LSILAGRMTLTAPGATAPVVSADNMRLDVKLLPLLSHQLFVKQVMLKNAVIRLTPDSEEQ
TQPDAPIAPAGHSEESAEAPWKFDIDNLRVVDSLLIWQRANNEQINVRDINLTLQQNAKR
QAQMELSSRVNRNQRDLSFSMAADIDLQQFPRRIAANVSQFSYQLEGADILAGGIKGEGS
AQVVYQQTPQQVALSQLSVSANDSTFTGDADIKFGEIPAYTLNLASTVLNLDTFTGWQAS
SSQAQPSQVVTSAPVIASQMDDPQHNLEVLRDFNAQLNLSVDQLTYRGMNIAHLVLQADN
RQGLLTSHSLSGQLAGGDFALPGTLDARGSRPVITVQPVVKQVELGTVLKAFEMPQVLTG
KFSMQGDLTGDRFTSQSFERRWQGTAQMTMQDAQLHGLNIQQLIQQAVARNDSSVRGQDE
YQRYTEVKQLSAKASLNRGTVKITELGADSPLLNLSGGGTVDMPGKQCDMALNVRVTGGW
QGRDDLIQQLQKTPIPLRVYGPWNQLNYQLQVDQILRKTLQDRAKDALNKWAEKNQDSRE
GQDLKKLLDKL