Protein Info for IAI46_07965 in Serratia liquefaciens MT49

Annotation: iron-sulfur cluster carrier protein ApbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF10609: ParA" amino acids 107 to 350 (244 residues), 334.1 bits, see alignment E=1.3e-103 PF13614: AAA_31" amino acids 109 to 147 (39 residues), 39.6 bits, see alignment 1.4e-13 PF09140: MipZ" amino acids 110 to 228 (119 residues), 34.7 bits, see alignment E=3e-12 PF01656: CbiA" amino acids 111 to 252 (142 residues), 44.4 bits, see alignment E=3.8e-15

Best Hits

Swiss-Prot: 80% identical to APBC_ECOL6: Iron-sulfur cluster carrier protein (mrp) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 98% identity to spe:Spro_1574)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>IAI46_07965 iron-sulfur cluster carrier protein ApbC (Serratia liquefaciens MT49)
MNAKSPEQTNPEVLRALVTGVLAAFEHPTLKNNLTALKAIHHCALLDNVLHIELTMPFAW
QSGFEALKDSVSAELLRVTGAEAIDWKLKHDITTLKRANDQAGIKGVRNIIAISSGKGGV
GKSTTAVNLALALAAEGAKVGILDADIYGPSIPNMLGTENERPTSPDGQHMAPIVAHGLA
TNSIGYLVTDDNAMVWRGPMASKALMQLLQDTLWPDLDYLVLDMPPGTGDIQLTLSQNIP
VTGALVVTTPQDIALLDAAKGIVMFEKVHVPVLGIVENMSVHICSNCGHHEPIFGTGGAE
KLVKKYHSRLLGQLPLHISLREDLDRGAPTVISRPDSEFAELYRQLAGRVAAQMYWQGEA
IPTEISFRAL