Protein Info for IAI46_07940 in Serratia liquefaciens MT49

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01355: cytidine deaminase
  • amino acids 31 to 285 (255 residues), 288 bits, E=3.7e-90
• PF00383: dCMP_cyt_deam_1
  • amino acids 61 to 140 (80 residues), 53.1 bits, E=2.5e-18
• PF08211: dCMP_cyt_deam_2
  • amino acids 157 to 278 (122 residues), 160.2 bits, E=2.9e-51

Best Hits

Swiss-Prot: 94% identical to CDD_SERP5: Cytidine deaminase (cdd) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 94% identity to spe:Spro_1568)

MetaCyc: 68% identical to cytidine/deoxycytidine deaminase (Escherichia coli K-12 substr. MG1655)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (10/10 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleosides degradation (3/3 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• pyrimidine ribonucleosides degradation (2/2 steps found)
• pyrimidine ribonucleosides salvage II (2/2 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• superpathway of pyrimidine ribonucleosides degradation (3/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Protein Sequence (294 amino acids)

>IAI46_07940 cytidine deaminase (Serratia liquefaciens MT49)
MHPRFQTAFAELPATLQSALLPYFDAPDFPAMLKAEQVDAIKQRCGLDDDALAFALLPLA
AACSLAPISQFYVGAIARGQSGNLYFGANMEFSGAPMQQTIHAEQCAVTHAWLRGESALA
SITVNYTPCGHCRQFMNELNSGTTLKIRLPGREPATLGDYLPDAFGPKDLNIATLLMDRV
DHGFQLTLTDELEMAALAAANQSHAPYSNAHSGVALEAEDGTIYSGRYAENAAFNPSLPP
LQAALILMNVSGGDCQKVVRAVLAEPDSAILTQWDATRATLAALGCQNVSRITF