Protein Info for IAI46_07845 in Serratia liquefaciens MT49

Annotation: dipeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 42 to 206 (165 residues), 96.3 bits, see alignment E=6.6e-31 amino acids 345 to 496 (152 residues), 119.5 bits, see alignment E=4.5e-38 PF08352: oligo_HPY" amino acids 257 to 289 (33 residues), 27.8 bits, see alignment (E = 6.4e-10) amino acids 548 to 580 (33 residues), 30.7 bits, see alignment (E = 8.5e-11)

Best Hits

Swiss-Prot: 79% identical to GSIA_PECAS: Glutathione import ATP-binding protein GsiA (gsiA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K13892, glutathione transport system ATP-binding protein (inferred from 97% identity to spe:Spro_1550)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>IAI46_07845 dipeptide ABC transporter ATP-binding protein (Serratia liquefaciens MT49)
MTDALMPLAADAGLLLPPQRVLSVRDLSVQFQQQGDTVEAVRNLSFDLDRGETLAIVGES
GSGKSVTSLALMRLVEQGGGNIVSGTMPFRRRNGEVLDLAHARQGTLRTVRGADMAMIFQ
EPMTSLNPVFPVGEQIAESLRLHQAMDHRAARQAALQMLDLVRIPETKDVLNRYPHQLSG
GMRQRVMIAMALSCKPALLIADEPTTALDVTIQAQILQLIRVLQQEMQMGVIFITHDMGV
VAEIADRVLVMRQGEQVEQGPVRELFAAPQQPYTQALLAAVPRLGSMADLDFPAKFPLPN
GADNGGPQDTVPPGATPILRVENLVTRFDLRSGILNRVTRRVHAVENVSFDLYPGETLGL
VGESGCGKSTTGRSLLKLVDSQRGTITFDGRQINQLKGPALQHLRRDIQFIFQDPYASLD
PRLTVGFSIMEPLLVHNVARGKAAQERVAWLLERVGLKPEHARRYPHEFSGGQRQRICIA
RALALNPKVVIADESVSALDVSIQAQIVNLLLDLQREFGIAFLFISHDMAVVERISHRVA
VMYLGQIVEIGPRRAVFENPQHAYTRKLMAAVPVADPNHAYKRQPLLVDEIPSPIRALGD
EPVTAPLVQVGPGHFVARHPIAGAF