Protein Info for IAI46_07810 in Serratia liquefaciens MT49

Annotation: transcriptional regulator CynR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF00126: HTH_1" amino acids 3 to 61 (59 residues), 98.7 bits, see alignment E=2.2e-32 PF13556: HTH_30" amino acids 13 to 53 (41 residues), 28.1 bits, see alignment 2.1e-10 PF03466: LysR_substrate" amino acids 88 to 289 (202 residues), 166.5 bits, see alignment E=8.3e-53

Best Hits

Swiss-Prot: 54% identical to CYNR_ECO57: HTH-type transcriptional regulator CynR (cynR) from Escherichia coli O157:H7

KEGG orthology group: K11921, LysR family transcriptional regulator (inferred from 79% identity to spe:Spro_1535)

Predicted SEED Role

"Cyn operon transcriptional activator" in subsystem Cyanate hydrolysis or DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>IAI46_07810 transcriptional regulator CynR (Serratia liquefaciens MT49)
MLLRHIRYFLAVAEQGNFTRAAEALHVSQPTLSQQIKQLEENLGTPLFDRSGRTVRLTDA
GMAWMRYARLALQDLEAGTRAIHDVATLERGNLRLAMTPTFTAYLVGPVIDAFYRQYPGV
SVSIHEMTQDRIEALLAEDRLDVGIAFSQAQSVDIVAEELFTESLNMMVGAQHPLVQQRE
PLSAQVFEQQPLVLLSEDFATRQFIDDYCRRQGIRPRVAMEANAIGAIIEIVRRGQLATL
LPAAVAQENPQLHPVRLTDVMPARRAVLLQRKDAYRSAASRAFIEVLHRQKFSQGHSDPL