Protein Info for IAI46_07635 in Serratia liquefaciens MT49

Annotation: heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 11 to 470 (460 residues), 464 bits, see alignment E=3e-143 PF00672: HAMP" amino acids 192 to 245 (54 residues), 40.2 bits, see alignment 5.1e-14 PF00512: HisKA" amino acids 250 to 315 (66 residues), 49.7 bits, see alignment E=4.6e-17 PF02518: HATPase_c" amino acids 359 to 468 (110 residues), 71.6 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 88% identity to spe:Spro_1499)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>IAI46_07635 heavy metal sensor histidine kinase (Serratia liquefaciens MT49)
MKAVIQRWRVLSLTLRSAMLFALVAALVVSGAGGYLYGAMRQEMTTRSDLQVTGRVEYYR
NLLSQRFPLERLTANTGLFENMLGNEQDVLIFQQPGKKPLINVNPARLILPPVIPTPVGT
PQRLSAVKGGMTAQGVPLRAASALVRLEDGNLLQISAAHVMVNEQKMLARYLWRIVAAVA
VAFILIALLGYWVMRRGLQPLWRMAAQAAVITPNTLSTRLSEHGVPKELQQLTRSFNAML
DRLNEGYLRLTQFSADLAHEIRTPVGALMGHCQVALYQARSVEEYETLLSNNMEELERIS
RMVENILFLARASEGQAVLNPQRLDVAQELQRVADYFEGLAEERGITLVCQGEGQWMADA
MLFQRALSNLVSNAVRYADENSQVQLQAVSQADGGLAILVINQGPPISPAHLNKLFDRFY
RADAARSSGSHASGLGLAIVRAIMTLHGGTAHAHCVVEENTARITFSLIFPAQE