Protein Info for IAI46_07605 in Serratia liquefaciens MT49

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02737: 3HCDH_N
  • amino acids 9 to 56 (48 residues), 22.4 bits, 1.5e-08
• PF03446: NAD_binding_2
  • amino acids 9 to 168 (160 residues), 136.7 bits, E=1.2e-43
• PF14833: NAD_binding_11
  • amino acids 172 to 291 (120 residues), 117.5 bits, E=6.3e-38

Best Hits

Swiss-Prot: 80% identical to LTND_PECAS: L-threonate dehydrogenase (ltnD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08319, putative dehydrogenase [EC: 1.1.-.-] (inferred from 97% identity to spe:Spro_1492)

MetaCyc: 75% identical to L-threonate 2-dehydrogenase (Haemophilus influenzae Rd KW20)
RXN-18590 [EC: 1.1.1.411]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

• L-threonate degradation (3/4 steps found)
• ketolysis (2/3 steps found)
• ketogenesis (2/5 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Bisphenol A degradation
• Butanoate metabolism
• Ethylbenzene degradation
• Limonene and pinene degradation
• Naphthalene and anthracene degradation
• Retinol metabolism
• Synthesis and degradation of ketone bodies
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.-.-

Use Curated BLAST to search for 1.1.-.- or 1.1.1.30 or 1.1.1.411

Protein Sequence (304 amino acids)

>IAI46_07605 NAD(P)-dependent oxidoreductase (Serratia liquefaciens MT49)
MTQPGDFAVCIVGLGSMGMGAAKSCINAGLTTYGVDLNPQALATLQQAGAKQAATSADGF
ASELDALLLLVVNAAQVKQILFGENGLAAKLKPNTPVMVSSTISAADARQIEQQLLALGL
NMLDAPVSGGAAKAAEGQMTVMASGAESTFQQLQPVLDAIAGKVYRIGEEIGLGATVKII
HQLLAGVHIAAGAEAMALAARAGIPLDVMYDVVTHAAGNSWMFENRMRHVVDGDYAPKSA
VDIFVKDLGLVADTAKALHFPLPLASTAFNMFTAASNAGFGKEDDSAVIKIFSGIDLPQK
KENA