Protein Info for IAI46_07565 in Serratia liquefaciens MT49

Annotation: outer membrane protein OmpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF06316: Ail_Lom" amino acids 4 to 112 (109 residues), 55.5 bits, see alignment E=6.8e-19 amino acids 118 to 172 (55 residues), 30 bits, see alignment E=4.3e-11 PF13505: OMP_b-brl" amino acids 9 to 172 (164 residues), 77.1 bits, see alignment E=1.9e-25

Best Hits

Swiss-Prot: 73% identical to OMPX_ENTCL: Outer membrane protein X (ompX) from Enterobacter cloacae

KEGG orthology group: K11934, outer membrane protein X (inferred from 99% identity to spe:Spro_1484)

Predicted SEED Role

"Attachment invasion locus protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>IAI46_07565 outer membrane protein OmpX (Serratia liquefaciens MT49)
MKKIACLSAVAACVLAVTAGTAFAGQSTVSAGYAQGDLQGVANKADGFNLKYRYEFDNNP
LGVIGSFTHVEKNGSENGYYGKAQYNSITAGPAYRFNDWASIYGVVGVGYGKNIDNAQNG
TDRNGSSDYGFTYGAGLQFNPIQDVALDVGYEQSRIRSVDVGIWSVGVGYRF