Protein Info for IAI46_07560 in Serratia liquefaciens MT49

Annotation: threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF00892: EamA" amino acids 150 to 279 (130 residues), 71.1 bits, see alignment E=5.5e-24

Best Hits

Swiss-Prot: 72% identical to RHTA_SALTS: Threonine/homoserine exporter RhtA (rhtA) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_1483)

MetaCyc: 69% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>IAI46_07560 threonine/homoserine exporter RhtA (Serratia liquefaciens MT49)
MSSSATAKASSTLLPICLLVIAMVSIQSGASLAKSLFPLVGAEGITTLRLSIGTLILFII
FRPWRMRFAAGSRLPLFIYGLALGAMNYLFYLSLRTLPLGIAVALEFTGPLAVAMFSSRR
AIDFLWVALAIAGLWFLLPLGHDMGSIDPFGAACALGAGACWAVYIICGQKAGGDHGPGT
VAVGSLIAAVVFCPIGAWQAGSALLNVDILPVALAVAILSTALPYSLEIIALPKIPARTF
GTLMSLEPALAALSGMLFLNEHLTTVQWLALAAIITASMGATLTIKPKPQIENLS