Protein Info for IAI46_07515 in Serratia liquefaciens MT49

Annotation: PAS domain-containing methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR00229: PAS domain S-box protein" amino acids 18 to 133 (116 residues), 49.7 bits, see alignment E=2e-17 amino acids 139 to 249 (111 residues), 66.8 bits, see alignment E=1e-22 PF00989: PAS" amino acids 22 to 118 (97 residues), 31.6 bits, see alignment E=4.4e-11 amino acids 146 to 246 (101 residues), 36 bits, see alignment E=1.8e-12 PF08448: PAS_4" amino acids 24 to 127 (104 residues), 35.4 bits, see alignment E=3.2e-12 amino acids 145 to 248 (104 residues), 65.4 bits, see alignment E=1.6e-21 PF13426: PAS_9" amino acids 24 to 118 (95 residues), 48 bits, see alignment E=4.1e-16 amino acids 147 to 247 (101 residues), 49.7 bits, see alignment E=1.1e-16 PF08447: PAS_3" amino acids 35 to 120 (86 residues), 57.4 bits, see alignment E=4.4e-19 amino acids 157 to 242 (86 residues), 48.4 bits, see alignment E=2.8e-16 PF00015: MCPsignal" amino acids 266 to 426 (161 residues), 115.4 bits, see alignment E=7.9e-37

Best Hits

Swiss-Prot: 44% identical to BDLA_PSEAE: Biofilm dispersion protein BdlA (bdlA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 92% identity to spe:Spro_1472)

Predicted SEED Role

"Putative chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>IAI46_07515 PAS domain-containing methyl-accepting chemotaxis protein (Serratia liquefaciens MT49)
MLLRFSQLNTHSRAELSAIENAVAMIVFKPDGTVLRANDLFLKTMGFQRQEVIGQHHRLF
CSPEYVVSPAYRKHWDMLNNGKPITDNIKRIRKDGEAVWLQGTYTPVMNKQGRVVEIVKI
ASVVTERITQAQEHQSLLSALNRSMAMITFDAQGKILAANDNMLKLMGYRIEEARGQAHA
VLCPPEFAHSDDYRQHWRRLARGEFITGRFERVNRRGERVWLEASYNPILDDDGQVVKVV
KIAQDITRQMIQQQHEEEMVRNAHHLSLDTDRTAAQGAVIVQQVVAGMQQVEAAARDTSA
VVSELGIGSQQIGTMVEAIRKIASQTNLLAINASIEAAHAGEHGRGFAVVANEVRTLAEQ
SRQAATEIERITKSIQQGVAAAIAGMAVCVEQAGGGVALTHDAGEVINRVNIGMQDVVKL
MQTFTTVQQGESLH