Protein Info for IAI46_07490 in Serratia liquefaciens MT49

Annotation: DNA-binding protein YbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 5 to 68 (64 residues), 47.5 bits, E=1.2e-16
• PF00591: Glycos_transf_3
  • amino acids 94 to 318 (225 residues), 28 bits, E=1.7e-10

Best Hits

Swiss-Prot: 63% identical to YBIB_ECOLI: Uncharacterized protein YbiB (ybiB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to srs:SerAS12_1455)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase like (EC 2.4.2.18)" (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Protein Sequence (319 amino acids)

>IAI46_07490 DNA-binding protein YbiB (Serratia liquefaciens MT49)
MDYTKIIKEIGRGKNHARDLDRETAFQLYQKMLAGEVGELELGGILIALRIKGEAEEEML
GFYQAMQQQVMRLQVPQGRPMPVVLPSYNGARKQANLTPLLALLLTRVGLPVVVHGVLDD
STRVTSAETFQALGLPWSPDAAHAQRRLDNGETVFIPVSALSAPLDLQLGLRWRMGVRNS
AHTLAKLATPFGEQDVLRIASVSHPEYVGRVASFFRQIGARGLLMHGTEGEAYANPQRCP
QIHYIVNGEQQVLLERPEQDPTPELPAAKDAETTARWTERCLAGDVAIPLAIQRQIACCL
LAAGEVDTLEQGLERLRSA