Protein Info for IAI46_07480 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 105 to 107 (3 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 338 to 362 (25 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details amino acids 442 to 465 (24 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 418 (401 residues), 152 bits, see alignment E=1.1e-48

Best Hits

KEGG orthology group: None (inferred from 91% identity to spe:Spro_1465)

Predicted SEED Role

"Putative transmembrane efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>IAI46_07480 MFS transporter (Serratia liquefaciens MT49)
MEQSLAQGDRRLVGLPVLLLGGFVTVFDLFVVNVAAPVIQQQFAASFAGVGLIIAGYELA
FGVLLIAGGRLGDRFGRQRMFSLGMLGFTLTSALCGMATSLSMLIVARFLQGAAAALLFP
QIYALMRVLYNPHQRRRAFAWLGMTLGLAAIFGQIFGGFIIEADVFGSGWRMIFLINLPI
GVLAIVAARRIPESRLEQAQRLDGMGLLLAATGLLLMLVPLLEGPSRGWPWWVLPALACG
IGMLWAFIRWERRLAQRSGDAVLDPALLRQGSFTPGVAVVLAIYSTASSFFLCFALLLQA
GIGLTPFQAGSLFAPASAAFMLASFLAPGLVQRWGNGVLALGVAVYAAGMALLVVEVLSG
AALVQPLWLLPGLVILGFGQALSMTPLLNLVLGLAKEHQAGMAAGVISTVQQVGGALGIA
ASGAFFVPLLAGGAGAERYGQAFAGAMVYNLLAMAVAFGLLRWIIQKQRKLALQ