Protein Info for IAI46_07460 in Serratia liquefaciens MT49

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 19 to 423 (405 residues), 246.7 bits, see alignment E=2.2e-77 PF07690: MFS_1" amino acids 24 to 414 (391 residues), 192.7 bits, see alignment E=9.1e-61 PF00083: Sugar_tr" amino acids 50 to 196 (147 residues), 28.6 bits, see alignment E=6.9e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to srs:SerAS12_1449)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>IAI46_07460 DHA2 family efflux MFS transporter permease subunit (Serratia liquefaciens MT49)
MSERSEILTDSGTPQLWRLLIGISIASFLGCIDFTIVNTTIPAIQRELAASLSSVQWVMT
LFVMALCAFMVSAGRLADLYGRRRVLYCAMLTFAAASLGAGLSGSIELLNVWRFVQGAAC
AVLYTATTAIVADAWPPQQRGRAIGILLAVNGLGLAIGPVAGGLLVGSLGWRWVFLLNVP
LIALSFAFCLGTVRESRAQQGSRLDIPGLLLLVIGVAGLLLAISQGSQWGWLSAKTGLTA
ALALAALGLLLPVERRAHSPLVPLVLLRRPAFLRVCLMSALLAFFYCAAFFLMPIYLENT
RHYQGTMLGLLLLPTTAVMAALSPWVGRWVDKSGPRAALILGFATLAGSAALQSRFSVDS
PLPLLLGAFALMGMGWGCILGPLVLATLNSVSESQSGGALGITWTLHNLGGAVGLAVATL
IYPSYGYTPVMLLLLALSLFGGLLAAWRSR