Protein Info for IAI46_07425 in Serratia liquefaciens MT49

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00583: Acetyltransf_1" amino acids 55 to 133 (79 residues), 48.2 bits, see alignment E=3.8e-16 PF13673: Acetyltransf_10" amino acids 57 to 133 (77 residues), 35.5 bits, see alignment E=2.7e-12 PF13508: Acetyltransf_7" amino acids 58 to 133 (76 residues), 33.3 bits, see alignment E=1.5e-11 PF08445: FR47" amino acids 76 to 136 (61 residues), 31 bits, see alignment E=6e-11

Best Hits

KEGG orthology group: None (inferred from 87% identity to spe:Spro_1457)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>IAI46_07425 GNAT family N-acetyltransferase (Serratia liquefaciens MT49)
MHTDESFEYQSALRYSSDELAQILCHCFENYIVRFVIDGDTFARRFGAEDLSLNDSIIVT
HQQQPVALALISRRGLHSRISALSIRPEMRGKGLGKALMKRIVADAHQRGDRQLSLEVIE
GNEAALALYHRAGLQIVRTLTGHLAATPVLAEVAQLQEIDPLFVSHRLIAEGATDLPWLI
APETLFKLPGKPHAFSLGHQAYAVVQLGADKCFLRMIYVPPQHRSQGHARTMLAALQAKF
APLPLVANVYVPEVAAPFFDRLGWQQDALRQFEMTMTLNTPQ