Protein Info for IAI46_07170 in Serratia liquefaciens MT49

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 87 to 116 (30 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 231 to 247 (17 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 31 to 283 (253 residues), 258.7 bits, see alignment E=2.7e-81 PF00528: BPD_transp_1" amino acids 109 to 271 (163 residues), 33.1 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 96% identity to srs:SerAS12_1392)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>IAI46_07170 phosphonate ABC transporter, permease protein PhnE (Serratia liquefaciens MT49)
MITAPTLTAEGMQALKQQHPEIFSQQRRYLRTVGIIAVAIALYYLFFFQFFGISWPQFVN
GCHQLGRYFMRMFVWHDFVNWPFMYYFQQIFITIGIVFAGTITASLIALPLSFFAARNVM
STPLLRPISVVVRRFLDIFRGIDMAIWGLIFVRAVGMGPLAGVLAIVMQDVGLLGKLYAE
GHEAVDKSPSRGLTAVGANGLQKHRYGIFTQSFPTFLALSLYQIESNTRSAAVLGFVGAG
GIGLVYAENMRLWNWDVVMFITLILVVVVMIMDKVSSILRNKYIIGEDIPLYQQKSQID