Protein Info for IAI46_07150 in Serratia liquefaciens MT49

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF08240: ADH_N" amino acids 28 to 132 (105 residues), 117.1 bits, see alignment E=7e-38 PF01262: AlaDh_PNT_C" amino acids 163 to 209 (47 residues), 23 bits, see alignment 9.4e-09 PF00107: ADH_zinc_N" amino acids 173 to 300 (128 residues), 82.3 bits, see alignment E=6e-27 PF13602: ADH_zinc_N_2" amino acids 218 to 321 (104 residues), 27.3 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 72% identical to LGOD_ECOLI: L-galactonate-5-dehydrogenase (lgoD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to srr:SerAS9_1388)

MetaCyc: 72% identical to L-galactonate oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5229 [EC: 1.1.1.414]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.414

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>IAI46_07150 zinc-binding alcohol dehydrogenase family protein (Serratia liquefaciens MT49)
MTTMKTLVCEQPTKLVYQRRPVPFPAAQEVVIKIITVGICGTDIHAWSGHQPFFSYPRVL
GHEICGEIVSVGNNTTDWQVGQRVAVMPYISCHRCGACQSGKTNCCENISVIGVHQDGGF
CEYLSVPIGNLLAVDDVAPEAAALIEPFAISAHAVRRAGIAADDQLLVVGAGPIGLGVAA
IAKADGAQVVVADTSAERRRHVEQVLQLPTLDPQDERFDAALRGQFDGKLAAKVIDATGN
PQAMNHAVDLIRHGGSIVFVGLFKGDLQFSDPEFHKKETTLMGSRNATGEDFAKVGRLMA
AGKITAQMMLSHHFDFDTLAEHYEAQVINNRQLIKGVIHFQ