Protein Info for IAI46_07055 in Serratia liquefaciens MT49

Annotation: bifunctional helix-turn-helix transcriptional regulator/GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01047: MarR" amino acids 30 to 85 (56 residues), 34.2 bits, see alignment E=5.9e-12 PF12802: MarR_2" amino acids 30 to 84 (55 residues), 35.8 bits, see alignment E=2.1e-12 PF00583: Acetyltransf_1" amino acids 186 to 281 (96 residues), 50.6 bits, see alignment E=6.6e-17 PF13508: Acetyltransf_7" amino acids 196 to 282 (87 residues), 43.2 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 91% identity to spe:Spro_1391)

Predicted SEED Role

"Transcriptional regulator, MarR family / Acetyltransferase (GNAT)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>IAI46_07055 bifunctional helix-turn-helix transcriptional regulator/GNAT family N-acetyltransferase (Serratia liquefaciens MT49)
MNIRDFRALSRNLVRELGMLNKQSNGSRFSPLQIHILIEISTLPLGVTELATRLCIDKAS
ASRAVRSLVAAGMIEAVDYPHDKRHNLNQLTRLGRKTLAAIDTNADGFMQDALAQLDDDE
LAATTAAMKKMTSALRNARKQRDAALRVRPITQDDDAAMAGIICNVFREYGMDKMEGVSL
HDPDLDRLTGVYQDNGGKYWVLEQEGQVVGGVGIAPLAGGDVGYCELQKLFFKPSVRGLG
MARYMVVQALKAARAAGYRYCYLETTEQLKEALGLYYALGFTLLTERRGNTGHHGCNIYL
LKNLQSD