Protein Info for IAI46_06965 in Serratia liquefaciens MT49

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00005: ABC_tran" amino acids 23 to 158 (136 residues), 88 bits, see alignment E=9.4e-29 PF13304: AAA_21" amino acids 126 to 190 (65 residues), 29.6 bits, see alignment E=7e-11

Best Hits

Swiss-Prot: 50% identical to Y1470_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_1470 (HI_1470) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 91% identity to spe:Spro_1374)

Predicted SEED Role

"ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>IAI46_06965 ABC transporter ATP-binding protein (Serratia liquefaciens MT49)
MAETLLTAQDLSFGWPGQAPLFNALSLQLSRGEVLAVLGPNGRGKSTLMQLLLGTLPLQQ
GAVECAGGIGFVPQHFTAPFAYRVLDIVLMGRARYVGLFRSPSAQDHRLAKEALQSLDML
GFADREFGSLSGGQRQLVLIARALAMSCEVLILDEPTSALDLHHQDRVLSLISSLARERQ
MAVMFSTHQPNHAHAVADRALLLGAEGQHQIGPCAKVLTAECLSPLFDLAIERVALQIEG
RQFETLVPLYRSQRERHHE