Protein Info for IAI46_06855 in Serratia liquefaciens MT49

Annotation: N-acetyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF13302: Acetyltransf_3" amino acids 7 to 144 (138 residues), 30.5 bits, see alignment E=1.3e-10 PF13420: Acetyltransf_4" amino acids 12 to 164 (153 residues), 42.9 bits, see alignment E=1.4e-14 PF13673: Acetyltransf_10" amino acids 33 to 148 (116 residues), 24.8 bits, see alignment E=4.6e-09 PF00583: Acetyltransf_1" amino acids 37 to 144 (108 residues), 45.6 bits, see alignment E=2e-15 PF13508: Acetyltransf_7" amino acids 59 to 144 (86 residues), 31.7 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 60% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 82% identity to srs:SerAS12_1322)

Predicted SEED Role

"Phosphinothricin N-acetyltransferase (EC 2.3.1.-)" (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>IAI46_06855 N-acetyltransferase family protein (Serratia liquefaciens MT49)
MPHTAPLNLADATPDDIAAIQQIYAHHVLFGAASFEETPPTQEEMRQRLGKVQEAGLPWL
VAKRGHLVVGYCYATPYRPRPAYRFTVEESVYIAEGQQGQGIGKALLIELIARCERGPWR
QMLAVVGNAGENHGSLALHQKLGFGSVGTLKAVGFKLGKWRDTHIMQRALGEGGDNPPDG
LAASNLRIIDYSK