Protein Info for IAI46_06850 in Serratia liquefaciens MT49

Annotation: DUF808 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 71 to 99 (29 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 274 to 274 (1 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details PF05661: DUF808" amino acids 4 to 292 (289 residues), 399.1 bits, see alignment E=5.9e-124

Best Hits

Swiss-Prot: 60% identical to YEDI_ECOLI: Inner membrane protein YedI (yedI) from Escherichia coli (strain K12)

KEGG orthology group: K09781, hypothetical protein (inferred from 97% identity to spe:Spro_1355)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>IAI46_06850 DUF808 domain-containing protein (Serratia liquefaciens MT49)
MAGSSLLTLIDDIASLLDDVSLMTKMAAKKTAGVLGDDLALNAQQVTGVKADRELPVVWS
VAKGSFINKAILVPLALLISAFAPWAITPLLMVGGAYLCYEGFEKVFHSLTHKKQDGEEN
KEALNANEDVAAYEQRKVKGAIRTDFVLSAEIIAITLGTVAGATFSQQVIVLCGIAIVMT
VGVYGIVAGIVKLDDLGLYLSRKSSALARSIGSGIVSAAPYLMKTLSVVGTIAMFMVGGG
ILTHGLPPVHHLFEDWASYATVVPTFGQILQGVIPALLNVVFGLVAGGVVLLVVSALGAI
RGRLKA