Protein Info for IAI46_06795 in Serratia liquefaciens MT49

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF01810: LysE" amino acids 19 to 207 (189 residues), 130.6 bits, see alignment E=2.6e-42

Best Hits

KEGG orthology group: None (inferred from 91% identity to srr:SerAS9_1313)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>IAI46_06795 LysE family transporter (Serratia liquefaciens MT49)
MISETALSVLSITGAIALGAMSPGQSFILVARTAVASSRRDGMAVALGMGVGCFIFALVA
LLGLQSLLLALPWLYSTLKVLGGAYLVYLAFKMLRGASQPLNVEAVGAQSLGLRKAFTTG
LLTQLSNPNTAIVFGSVFAALLSHKISPLMYIILPVIALTVDVLWYAFVAFVLSSPRPRR
AYLRFKAWFDRVGGGVLALLGVKLMLNR