Protein Info for IAI46_06780 in Serratia liquefaciens MT49

Annotation: L-asparagine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details PF00324: AA_permease" amino acids 35 to 474 (440 residues), 453.4 bits, see alignment E=9e-140 PF13520: AA_permease_2" amino acids 37 to 453 (417 residues), 143.9 bits, see alignment E=7.5e-46

Best Hits

Swiss-Prot: 82% identical to ANSP_SALTY: L-asparagine permease (ansP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11738, L-asparagine permease (inferred from 96% identity to spe:Spro_1347)

MetaCyc: 39% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"L-asparagine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>IAI46_06780 L-asparagine permease (Serratia liquefaciens MT49)
MQSNKKSAHDKHAARRRWLDSHESGYHKSMGNRQIQMIAIGGSIGTGLFLGTGGRLELAG
PALALVYLVCGIFSFFILRALGELVLHRPSSGSFVSYAREFLGEKASYVAGWMYFLNWAM
TGIVDITAVALYMHYWGTFADVPQWLFALCALGVVATMNMIGVKWFAEMEFWFALIKVVA
IALFLVVGVVFLGTGTPVAGNTTGLHLITENGGMFPHGLLPALVLVQGVIFAFAGIELIG
TAAGECKDPAKMMPKAINSVIWRIGLFYVGSVVLLVLLLPWNAYQAGQSPFVTFFSKLGV
PYIGTIMNIVVLTAALSSLNSGLYSTGRILRSLSMGGSAPKFMARMSSQQVPYAGILVTC
GIYVIGVLLNYLVPSRVFEIVLNIASLGIIASWAFIIVCQMRLRKAVREGRAQQVSFRMP
GAPFTSWLTLAFLLAVVIMMAFDYPNGTWTIATIPVLAVLLTLGWFGLRKRAQEVKLEQQ
AHEEAHH