Protein Info for IAI46_06610 in Serratia liquefaciens MT49

Annotation: secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16576: HlyD_D23" amino acids 43 to 319 (277 residues), 57.3 bits, see alignment E=2.1e-19 PF13533: Biotin_lipoyl_2" amino acids 44 to 91 (48 residues), 35.9 bits, see alignment 7.7e-13 PF13437: HlyD_3" amino acids 206 to 286 (81 residues), 46 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 78% identical to Y2891_YERE8: UPF0194 membrane protein YE2891 (YE2891) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 94% identity to spe:Spro_1329)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>IAI46_06610 secretion protein HlyD (Serratia liquefaciens MT49)
MNKKRSALIVAAIVLIAAAVYGVWYYQQQQDKPLTLYGNVDIRTVNLGFRVDGRLASLTV
DEGDALQPGQLLGKLDDAPYINALQQAQANVGSAKAKLALLLAGYRTEEIAQVRSEMAQR
LSAFSYADSYLKRQQGLWAKNATSADALEDARTARNQAQANLQASKDKLAQYLKGNRPQE
IEEAKANLAQSEAALAQAQLNLHDTTLVSPSAGTVLTRAVEPGTMLNAGGTVFTLSLTRP
VWVRAYVNEANLGKATPGTELEIYTDSRPNKPYHGKIGFVSPTAEFTPKSVETPDLRTDL
VYRLRVIVTDADDALRQGMPVTVHFAKP