Protein Info for IAI46_06575 in Serratia liquefaciens MT49

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 4 to 152 (149 residues), 239 bits, E=7.7e-76
• PF01967: MoaC
  • amino acids 15 to 150 (136 residues), 196.6 bits, E=8.2e-63

Best Hits

Swiss-Prot: 100% identical to MOAC_SERP5: Cyclic pyranopterin monophosphate synthase (moaC) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to spe:Spro_1322)

MetaCyc: 92% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Protein Sequence (159 amino acids)

>IAI46_06575 cyclic pyranopterin monophosphate synthase MoaC (Serratia liquefaciens MT49)
MTQLTHINAAGEAHMVDVSAKAETVREARAEAFVEMLPTTLAMIIEGSHHKGDVFATARI
AGIQAAKRTWELIPLCHPLMLSKVEVQLEAQPEHSRVRIETCCRLTGKTGVEMEALTAAS
VAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEL