Protein Info for IAI46_06570 in Serratia liquefaciens MT49

Annotation: molybdenum cofactor biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02667: molybdenum cofactor biosynthesis protein B
  • amino acids 7 to 169 (163 residues), 276.6 bits, E=5.7e-87
• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 12 to 152 (141 residues), 132 bits, E=1.6e-42
• PF00994: MoCF_biosynth
  • amino acids 14 to 156 (143 residues), 116.3 bits, E=4.9e-38

Best Hits

Swiss-Prot: 72% identical to MOAB_ECOLI: Molybdenum cofactor biosynthesis protein B (moaB) from Escherichia coli (strain K12)

KEGG orthology group: K03638, molybdenum cofactor biosynthesis protein B (inferred from 94% identity to spe:Spro_1321)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Protein Sequence (170 amino acids)

>IAI46_06570 molybdenum cofactor biosynthesis protein B (Serratia liquefaciens MT49)
MSHANSEFIPVHIAILTVSDSRGEAEDTSGQYLQEAALEAGHRVVDRAIVKDDKYLIRAR
VSTWIADETVQAVLITGGTGFTARDYTPEALLPLFDREVEGFGELFRMVSYEEIGTATVQ
SRALAGMANQTVIFAMPGSTRACRTAWERIIEEQLDARHRPCNFLPHLKK