Protein Info for IAI46_06535 in Serratia liquefaciens MT49

Annotation: malonyl-ACP O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF01209: Ubie_methyltran" amino acids 8 to 154 (147 residues), 37.1 bits, see alignment E=7e-13 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 16 to 254 (239 residues), 233.3 bits, see alignment E=1.8e-73 PF13489: Methyltransf_23" amino acids 36 to 176 (141 residues), 44.9 bits, see alignment E=3.2e-15 PF13847: Methyltransf_31" amino acids 45 to 155 (111 residues), 55.2 bits, see alignment E=2.2e-18 PF13649: Methyltransf_25" amino acids 51 to 138 (88 residues), 69.3 bits, see alignment E=1.1e-22 PF08241: Methyltransf_11" amino acids 51 to 142 (92 residues), 92.1 bits, see alignment E=8.7e-30 PF08242: Methyltransf_12" amino acids 51 to 140 (90 residues), 50.4 bits, see alignment E=9.3e-17

Best Hits

Swiss-Prot: 84% identical to BIOC_SERMA: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Serratia marcescens

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 92% identity to spe:Spro_1313)

MetaCyc: 55% identical to malonyl-acyl carrier protein methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11475 [EC: 2.1.1.197]

Predicted SEED Role

"Biotin synthesis protein BioC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.197

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>IAI46_06535 malonyl-ACP O-methyltransferase BioC (Serratia liquefaciens MT49)
MTSAFEQVNKQAVASAFSRAAVSYDAVAVLQRDVGERLLGMAQEHRGEQLLDAGCGTGYF
SRRWRELGKQVTALDLAPGMLAFARQQQAADHYLLGDIENVPLADAAVDISFSSLVVQWC
SDLPRALAELYRVTRPGGVILFSTLAEGSLHELGDAWQQVDGERHVNDFLPLAQIEAACA
GYRHHLQAEWQTLNYPDVMALMRSLKGIGATHLHQGREAGLLSRQRLAALQAAYPCRRGQ
FPLSYHLVYGVIYRD