Protein Info for IAI46_06465 in Serratia liquefaciens MT49

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13489: Methyltransf_23" amino acids 40 to 188 (149 residues), 29.5 bits, see alignment E=2e-10 PF05175: MTS" amino acids 41 to 101 (61 residues), 27.7 bits, see alignment E=7e-10 PF13847: Methyltransf_31" amino acids 43 to 176 (134 residues), 33.2 bits, see alignment E=1.5e-11 PF13649: Methyltransf_25" amino acids 45 to 145 (101 residues), 59.1 bits, see alignment E=2e-19 PF08241: Methyltransf_11" amino acids 46 to 148 (103 residues), 40.2 bits, see alignment E=1.5e-13 PF08242: Methyltransf_12" amino acids 46 to 147 (102 residues), 46.9 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: None (inferred from 85% identity to spe:Spro_1299)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>IAI46_06465 class I SAM-dependent methyltransferase (Serratia liquefaciens MT49)
MSSLSFSSLLTSWDQQQGAYIAEREARFNAQLDVLALSVGEDFHVLDLACGPGSLSLRIL
QRFPQAKVTAMDLDPLLLAIARGALAEYGDRIRILQADLADPECFSSLEGATPDAVVSST
ALHWLMPEQLTVLYRNIAERLPTGGVFLNADHQRYDHRQPRVKTLAELHDNQTQQQAWRN
GVEDWEQWFDKVQQLPELEQYRQQREKLFAGRPVPPATALDFQLASLTQAGFTEVGPVWQ
LLDDYVIAGWK