Protein Info for IAI46_06390 in Serratia liquefaciens MT49

Annotation: CDF family zinc transporter ZitB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 14 to 290 (277 residues), 317.9 bits, see alignment E=2.9e-99 PF01545: Cation_efflux" amino acids 18 to 210 (193 residues), 179.7 bits, see alignment E=2.9e-57

Best Hits

Swiss-Prot: 78% identical to ZITB_YERPE: Zinc transporter ZitB (zitB) from Yersinia pestis

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_1257)

MetaCyc: 68% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>IAI46_06390 CDF family zinc transporter ZitB (Serratia liquefaciens MT49)
MSDSPHVHLPKDSNSKRLLTAFLVTAVFMIAEVIGGLISGSLALLADAGHMLTDAAALLV
ALMAVHFSQRKPNARHTFGYLRLTTLAAFLNAAALLVIVVFILWEAIRRFFEPQPVMGTP
MLIIAIAGLLANLFAFWLLHRGSEEKNINVRAAALHVLGDLLGSVGAIAAAIVILTTGWT
PIDPILSVLVSCLVIRSAWRLLKESFHELLEGTPQEVDIAKLQKDLCLNIPEVRNIHHVH
VWQIGEQKLMTLHAQVIPPNDHDGLLRRIQGYLLEHYRIGHVTIQMEYQHCDTPDCGINR
APEPSDHSHSGSHSHLGHHH