Protein Info for IAI46_06380 in Serratia liquefaciens MT49

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 29 to 341 (313 residues), 403.3 bits, see alignment E=3.3e-125 PF02445: NadA" amino acids 31 to 340 (310 residues), 351.5 bits, see alignment E=1.7e-109

Best Hits

Swiss-Prot: 96% identical to NADA_SERP5: Quinolinate synthase A (nadA) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_1255)

MetaCyc: 84% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>IAI46_06380 quinolinate synthase NadA (Serratia liquefaciens MT49)
MSEMFDVNAAVYPFPPKPVPLDVAQKAFYREKIKTLLKQRNAVMVAHYYTDPEIQALAEE
TGGCVADSLEMARFGSNHPASTLLVAGVRFMGETAKILSPEKQVLMPTLHAECSLDLGCP
EEEFHAFCDSHPDRTVVVYANTSAAVKARADWVVTSSIAVELIEHLDSLGEKIIWAPDRH
LGNYVQKQTGADVLCWQGACIVHDEFKTQALMRMKALYPDAAILVHPESPQAVVDLADAV
GSTSQLIQAAKTLPNPQLIVATDRGIFYKMQQACPDKELFEAPTAGEGATCRSCAHCPWM
AMNGLKAIADGLEQGGALHEIHVDAALRQKALIPLNRMLDFAAQLKMQVKGNA