Protein Info for IAI46_06330 in Serratia liquefaciens MT49

Annotation: cell envelope integrity protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details TIGR02794: protein TolA" amino acids 13 to 202 (190 residues), 130 bits, see alignment E=6.6e-42 amino acids 183 to 420 (238 residues), 169.8 bits, see alignment E=5e-54 PF06519: TolA" amino acids 325 to 418 (94 residues), 123.3 bits, see alignment E=2e-40

Best Hits

Swiss-Prot: 56% identical to TOLA_ECOLI: Tol-Pal system protein TolA (tolA) from Escherichia coli (strain K12)

KEGG orthology group: K03646, colicin import membrane protein (inferred from 90% identity to spe:Spro_1278)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>IAI46_06330 cell envelope integrity protein TolA (Serratia liquefaciens MT49)
MVKATEQNDKLNRAVIVSVVLHFVLIALLIWGSLQENVDMNSAGGGGEGSVVGAVMVDPG
AVVEQYNRQQQQSNDAQRAEKQRQKKAEQQAEELQQKQAAEQQRLKELEKERLSAQEKAA
QDAKEQAEQQKQAAEQQKQVAEQQKQAAEQQKAAENAAAKAKEQQKVAEAAAAKAKAEAD
KVAKAQADAQKKAESEAKKEAAAAAAAKKQAEEAKKAAAAEAAEKKAAAEAEKKAAAEAE
KKAAADAEKKAAAEAEKKAAAAEKAAAEKAAAKKAADAKKKAAAAAAAQSSDVNDLFGDL
ADGKNAPKGGGAKAKGDGKPAGQGNAKAAGASGADIDGYAGQIRTAIQNKFYDASSFAGK
TCDLRIKLGPDGFLIDVKSVGGDPALCQAAVAAANQAKIPKPPSDAVYQHFKNSTLVFKP
Q