Protein Info for IAI46_06240 in Serratia liquefaciens MT49

Annotation: pyroglutamyl-peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF01470: Peptidase_C15" amino acids 3 to 201 (199 residues), 278.3 bits, see alignment E=2.5e-87 TIGR00504: pyroglutamyl-peptidase I" amino acids 3 to 211 (209 residues), 308.2 bits, see alignment E=1.8e-96

Best Hits

Swiss-Prot: 77% identical to PCP_YERPP: Pyrrolidone-carboxylate peptidase (pcp) from Yersinia pestis (strain Pestoides F)

KEGG orthology group: K01304, pyroglutamyl-peptidase [EC: 3.4.19.3] (inferred from 94% identity to spe:Spro_1260)

Predicted SEED Role

"Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)" in subsystem ZZ gjo need homes (EC 3.4.19.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.19.3

Use Curated BLAST to search for 3.4.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>IAI46_06240 pyroglutamyl-peptidase I (Serratia liquefaciens MT49)
MQKVLITGFEPFGGERVNPSWEVVKQLNDMELSGARIIARQLPCVFGAALEALNEAIDDV
QPVMVLAIGQAGGRTDITLERVAINIDDARIPDNQGQQPIDEPIVEKGPAAYFSTLPVKA
MVEAMREAGIPASVSQTAGTYVCNHVMYGLLHRLSKQQAIKGGFIHIPYLPEQAAVHPGA
PSMAATTVLFALELAVSIALQVEHDLKVVGGATH