Protein Info for IAI46_06235 in Serratia liquefaciens MT49

Annotation: DUF979 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 230 to 268 (39 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF06166: DUF979" amino acids 7 to 338 (332 residues), 404 bits, see alignment E=2.1e-125

Best Hits

KEGG orthology group: None (inferred from 97% identity to spe:Spro_1259)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>IAI46_06235 DUF979 domain-containing protein (Serratia liquefaciens MT49)
MTFQQQYLYWLAGVVLLIVAVMSFRDRANPRRITTGLFWALYGVVFLVGDWTYSLLGNVL
GEGSSEKRMLHIIVGVVVVVMALIAGFGGVRLGSYHQRTPQQREESAKRLGNRLFIPALA
IPVVTVVGVLLFNNIPALQTAVFGSGNHATLITLFSMTVGCLLGLVIAVKMTHEKALQPI
QEARRLLDSIGWAFILPQILATLGLLFTTAGVGTAISHLTQEYLAVDNRFIAVAVYAIGM
ALLTMVMGNAFAAFPIVTAGIGIPILVLQHGGNPAVMAAIGMFSGYCGTLMTPMAANFNI
VPAALLELPDKNAVIKAQVPTGVLLLLVNVFLLYFLMFL