Protein Info for IAI46_06225 in Serratia liquefaciens MT49

Annotation: 5-oxoprolinase subunit PxpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 3 to 235 (233 residues), 314.8 bits, E=2.1e-98

Best Hits

Swiss-Prot: 95% identical to PXPA_SERP5: 5-oxoprolinase subunit A (pxpA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07160, UPF0271 protein (inferred from 95% identity to spe:Spro_1257)

MetaCyc: 75% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• 5-oxo-L-proline metabolism (6/6 steps found)
• γ-glutamyl cycle (5/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Protein Sequence (245 amino acids)

>IAI46_06225 5-oxoprolinase subunit PxpA (Serratia liquefaciens MT49)
MNVDLNADLGEGCANDQALLQLVSSANIACGFHAGDAQTMRQSVRWALQYGVAIGAHPSF
PDRENFGRTRMQLPPEMVYAQVVYQLGALAAIARAEGGVMVHVKPHGMLYNQAAVEPALA
EAIARAVKAVDPALRLVGLAGSELIRAGEKQGLATRQEVFADRGYQADGTLVPRGQPGAL
ITSDELALAQTLEMVRHHRVRTLDGTWAAVRAETVCLHGDGEHALEYARTLRQRFAVEGI
NVSAE