Protein Info for IAI46_06135 in Serratia liquefaciens MT49

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00561: Abhydrolase_1" amino acids 20 to 243 (224 residues), 90.5 bits, see alignment E=4.4e-29 PF12146: Hydrolase_4" amino acids 21 to 114 (94 residues), 42.6 bits, see alignment E=1.4e-14 PF12697: Abhydrolase_6" amino acids 21 to 248 (228 residues), 82.4 bits, see alignment E=2.4e-26 PF00975: Thioesterase" amino acids 22 to 196 (175 residues), 27.2 bits, see alignment E=1.3e-09 PF03096: Ndr" amino acids 63 to 254 (192 residues), 25.6 bits, see alignment E=1.5e-09 PF07819: PGAP1" amino acids 81 to 136 (56 residues), 36 bits, see alignment E=2e-12

Best Hits

Swiss-Prot: 63% identical to YBFF_ECOLI: Esterase YbfF (ybfF) from Escherichia coli (strain K12)

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 95% identity to spe:Spro_1239)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>IAI46_06135 esterase (Serratia liquefaciens MT49)
MNFAMKLHYQLLATESDALPVILIHGLFGNLDNLGVLARDLNQQHSVVKVDLRNHGLSPR
SEVMTYPEMAQDLLTLLDDLQLEKVIVIGHSMGGKAAMALTAIAPQRVEKLIIIDVAPVD
YQTRRHDEIFVALQAVSAAGITQRQQAAELMRGYLNEEGVIQFLLKSFHQGEWRFNLPVL
IEEYENITGWQEVPAWPHPTLFIRGGLSPYVQDSYREDIARQFPQARAHVVAGTGHWVHA
EKPEAVLRAIHRFLGEA