Protein Info for IAI46_06080 in Serratia liquefaciens MT49

Annotation: ROK family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 147 to 165 (19 residues), see Phobius details PF01047: MarR" amino acids 25 to 63 (39 residues), 28.8 bits, see alignment 9e-11 PF00480: ROK" amino acids 89 to 392 (304 residues), 304.2 bits, see alignment E=1.2e-94

Best Hits

Swiss-Prot: 81% identical to NAGC_ECOL6: N-acetylglucosamine repressor (nagC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02565, N-acetylglucosamine repressor (inferred from 98% identity to srs:SerAS12_1197)

Predicted SEED Role

"N-acetylglucosamine-6P-responsive transcriptional repressor NagC, ROK family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>IAI46_06080 ROK family transcriptional regulator (Serratia liquefaciens MT49)
MSTGGQAQIGNVDLVKQLNGAAVYRLIDQQGPISRIQIAELSQLAPASVTKITRQLLERG
LIKEVDQQASTGGRRAISIVSETRHFHTVAVRLGRHDATITLYDMSGKSLGEEHYPLPER
TQETLENALFTAIAQFIEDYQRKLRELIAIAVILPGLVDPALGVVRYMPHISVSNWPLVD
NLQQRFNVTSFVGHDIRSLALAEHYFGATRDCEDSILVRLHRGTGAGIIVNGQIFLGNNG
NVGEIGHIQIDPLGERCHCGNFGCLETVAANAAIEHRVRQLLTQGYPSKLTLDDCSISAI
CKAANRGDLLASEVIEHVGRYLGKAVAIAINLFNPQKVVIAGEITEAEKVLLPAIQSCIN
TQVLKDFRKNLPVVTSELNHRSAIGAFALAKRAMLNGVLLQRLLES