Protein Info for IAI46_05970 in Serratia liquefaciens MT49

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF02525: Flavodoxin_2" amino acids 3 to 198 (196 residues), 169.4 bits, see alignment E=8.5e-54 PF03358: FMN_red" amino acids 16 to 171 (156 residues), 34.3 bits, see alignment E=1.8e-12

Best Hits

Swiss-Prot: 69% identical to AZOR_SALCH: FMN-dependent NADH-azoreductase (azoR) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: None (inferred from 91% identity to spe:Spro_1209)

MetaCyc: 68% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>IAI46_05970 FMN-dependent NADH-azoreductase (Serratia liquefaciens MT49)
MSRILVLKSSILGDYSQSGKLVDFFVQQWHEAHPNDSFTVRDLANPTLPELDGEVIGGFS
AGDKPLTPHQQKTLALSDELIAELKSHDTIIISAPMYNFNIPTQLKIYFDLVARAGQTFR
YTSEGSEGLVTGKKAIVISSRGGIHADTPTDLITPYLKLFLAFIGITDVEFVLAEGFAYG
PEAAEKAAQESRVAVAQKVPAKIDTVPQAEVATASAGGSFLGNLMKKLFG