Protein Info for IAI46_05945 in Serratia liquefaciens MT49

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 13 to 75 (63 residues), 41.8 bits, E=9.4e-15
• PF01467: CTP_transf_like
  • amino acids 14 to 194 (181 residues), 98.4 bits, E=2e-32
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 14 to 219 (206 residues), 194.8 bits, E=1.6e-61

Best Hits

Swiss-Prot: 95% identical to NADD_SERP5: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 95% identity to spe:Spro_1204)

MetaCyc: 60% identical to nicotinate-nucleotide adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide adenylyltransferase. [EC: 2.7.7.18]

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (25/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (6/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Protein Sequence (220 amino acids)

>IAI46_05945 nicotinate-nucleotide adenylyltransferase (Serratia liquefaciens MT49)
MSTNPQGTPVLHALFGGTFDPIHYGHLRPVEALAAEVGLNRVTLLPNHVPPHRPQPEANA
QQRLKMVELAIAGNPLFAVDDRELHRTTPSYTIETLEAIRKERGAALPLAFIIGQDSLLT
LHKWHRWQSLLDTCHLLVLARPGYNDRMDTPELQQWLEQHQVSDPAQLSRHPHGFIYLAD
TPQLEISATEIRQRRHQGLNCDDLLPRSVQRYIELQGLYR