Protein Info for IAI46_05890 in Serratia liquefaciens MT49

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details PF05230: MASE2" amino acids 19 to 106 (88 residues), 110.9 bits, see alignment E=2.6e-36 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 187 to 348 (162 residues), 175.5 bits, see alignment E=3.8e-56 PF00990: GGDEF" amino acids 190 to 345 (156 residues), 150 bits, see alignment E=5.3e-48

Best Hits

Swiss-Prot: 47% identical to DGCC_ECOLI: Probable diguanylate cyclase DgcC (dgcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to srs:SerAS12_1165)

MetaCyc: 47% identical to diguanylate cyclase DgcC (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"HmsT protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>IAI46_05890 diguanylate cyclase (Serratia liquefaciens MT49)
MYKPSVIDTRKSGLSFARRTYLPRIVGLGIGSLCVFSVFYTQNTAPWLWSLLILHGFIWP
HLAYQWARRSSQPFKAEIRNLLIDSFFGGLWVAMMAFNALPSVVILSMMGMNNIAAAGKP
LFFKGLGAQLAGALTIGALMGFPFQPESTASQVYLCLPMIYLYPILLGLVTYRTAKRLAE
KKQELLRISMRDGLTGLYNRRHWEHLLHHQFDSCRRYQHTATLILMDIDRFKTINDTFGH
ALGDEALAVLAEELLIGLRAVDIVGRYGGDEFGAVLPNTSAEQASIALLRIQERLNEVIF
REAPQLRLNISAGIADYHGEMSGYLDWLKAADNALYRAKNNGRNRLELAVPGH