Protein Info for IAI46_05820 in Serratia liquefaciens MT49

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 305 to 471 (167 residues), 157.8 bits, see alignment E=1e-50 PF00990: GGDEF" amino acids 309 to 468 (160 residues), 142.5 bits, see alignment E=5.3e-46

Best Hits

KEGG orthology group: None (inferred from 93% identity to spe:Spro_1181)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>IAI46_05820 diguanylate cyclase (Serratia liquefaciens MT49)
MDKAMNARINAKQGLPVAIQLITLFLLAYLLSLLGIFTRPIGSLSLFWPVNAILLGLLLR
KPAYASPAGWLITYLGMIAADLTNGESLSLALWLNACNMSLIATGYGVMLLLPQSQRRMG
KPQAILYMFTASLSGAAVASTLSILRNDSLYNNTAIIAWLAWFSEQFSTNLLLLPVLLAA
PRLKQLLRLQINWQLRASMPLLALLFSLVFSVYIGGPGAIAFPIPALLWCAVRYQLFTVT
LLTLLTGMTEISSISANLMLYETPNNHNAYLDTLMSARLGIAMLVMGPLILSSSIAVNRK
LLRRLEHSANHDFLTGVLARNALTRKAGEMLEHKYKSKEAVSLLLIDIDHFKQINDTHGH
LAGDQVLASFAHIVRRELRHDQLFGRLGGEEFAIMLPRALAAQGVALAEHLRQLVQKTEL
YPGGKVPLKITISVGVANLAMNEVKSLEQLMNMADIALYRAKSQGRNRVESFNVISGNSV
DHILFK