Protein Info for IAI46_05795 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 350 to 375 (26 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 401 (372 residues), 186.6 bits, see alignment E=9.7e-59 amino acids 263 to 435 (173 residues), 58.4 bits, see alignment E=9e-20 PF00083: Sugar_tr" amino acids 30 to 248 (219 residues), 96.8 bits, see alignment E=2.2e-31 PF06779: MFS_4" amino acids 46 to 202 (157 residues), 27.7 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 47% identical to PCAK_PSEPU: 4-hydroxybenzoate transporter PcaK (pcaK) from Pseudomonas putida

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 54% identity to reu:Reut_B5027)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>IAI46_05795 MFS transporter (Serratia liquefaciens MT49)
MSHGASLDIEAFIDQSPFSPFQWLLFLLCFLVIFMDGYDMAAIAYVAPSLLDEWGVQKAE
LGPAMSAALFGLAFGSLLSGPLADRVGRKPAVIYSVLLFGVFSLATAWSTSIGSLTLLRF
ITGLGLGAAMPNSITLLSEYCPSKRRTMIVSAMLCGFPLGAAVGGLLAGYLIPSFGWRSV
LVVGGVVPILLCVALPWLLPESVRYMVLKGYPSARIRAVLQRIKKEGVERAEHFVIAEKI
ADGHSAIRAILTSPHRTVTGLLWLSCFMSMLVFYMIVSWMPLLLKEAGLSVLQFSHISAL
FPLGGGVGSIVIGWVMDRREPNKVLALTYLVAGVLAYGVGLAVGNVTHTLLLGSLVFLMG
FASGGGQSALASLSASYYPTSCRATGVGSMYGVGRFGAIFGVLAGAELLRYQYPAAAIFS
LLLIPAWLVCLALMLKYFSGRRRELLLARLQDKH