Protein Info for IAI46_05770 in Serratia liquefaciens MT49

Annotation: 4-hydroxy-2-oxovalerate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03217: 4-hydroxy-2-oxovalerate aldolase
  • amino acids 4 to 336 (333 residues), 587.1 bits, E=5.1e-181
• PF00682: HMGL-like
  • amino acids 6 to 262 (257 residues), 217.1 bits, E=3.4e-68
• PF07836: DmpG_comm
  • amino acids 274 to 333 (60 residues), 104.4 bits, E=1.8e-34

Best Hits

Swiss-Prot: 83% identical to HOA2_CUPNH: 4-hydroxy-2-oxovalerate aldolase 2 (H16_B0552) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 83% identity to reh:H16_B0552)

MetaCyc: 79% identical to 4-hydroxy-2-oxovalerate aldolase (Pseudomonas putida F1)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]

Predicted SEED Role

"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)

MetaCyc Pathways

• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• catechol degradation I (meta-cleavage pathway) (4/5 steps found)
• L-tryptophan degradation IX (9/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (9/12 steps found)
• toluene degradation I (aerobic) (via o-cresol) (4/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
• p-cumate degradation (3/8 steps found)
• toluene degradation IV (aerobic) (via catechol) (6/13 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• p-cymene degradation (4/11 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aerobic toluene degradation (14/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.39

Use Curated BLAST to search for 4.1.3.39

Protein Sequence (345 amino acids)

>IAI46_05770 4-hydroxy-2-oxovalerate aldolase (Serratia liquefaciens MT49)
MKMKKLYISDVTLRDGSHAVRHRYSLPQVRQIATALDRAGVDSIEVAHGDGLSGSSFNYG
FGAHSDVEWIAAAAESVSHARIATLLLPGIGTVHDLRNAYDAGARVVRVATHCIEADISR
QHISYARELGMDTVGFLMMSHMAEPKHLAQQAKLMESYGATCVYVVDSGGAMLMQDIRDR
FRALREVLDENTEIGMHAHHNLALGVANSIVAVEEGCQRVDASLAGQGAGAGNAPLEVFI
ATAERLGWNHGCDLLQLMDAADDLVRPLQDRPVRVDRESLSLGYAGVYSSFLRHAEKAAE
QYQLKTADILLEVGRRRMVGGQEDMIVDVALDLLAQRNRLQENIA