Protein Info for IAI46_05765 in Serratia liquefaciens MT49

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 102 to 252 (151 residues), 39.8 bits, E=2.1e-14

Best Hits

Swiss-Prot: 54% identical to AMNE_PSESP: 4-oxalocrotonate decarboxylase (amnE) from Pseudomonas sp.

KEGG orthology group: K01617, 4-oxalocrotonate decarboxylase [EC: 4.1.1.77] (inferred from 58% identity to pol:Bpro_5137)

MetaCyc: 54% identical to 4-oxalocrotonate decarboxylase monomer (Pseudomonas sp. AP3)
4-oxalocrotonate decarboxylase. [EC: 4.1.1.77]

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (4/4 steps found)
• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• L-tryptophan degradation IX (9/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (9/12 steps found)
• 2-aminophenol degradation (3/4 steps found)
• 3-chlorocatechol degradation III (meta pathway) (3/4 steps found)
• catechol degradation to 2-hydroxypentadienoate II (3/4 steps found)
• 2-nitrobenzoate degradation I (5/7 steps found)
• orthanilate degradation (3/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (3/5 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• 4-amino-3-hydroxybenzoate degradation (3/6 steps found)
• 2,3-dihydroxybenzoate degradation (2/5 steps found)
• toluene degradation IV (aerobic) (via catechol) (6/13 steps found)
• 4-chloronitrobenzene degradation (3/9 steps found)
• 4-nitrotoluene degradation II (3/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (2/10 steps found)
• superpathway of aerobic toluene degradation (14/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.77

Protein Sequence (260 amino acids)

>IAI46_05765 fumarylacetoacetate hydrolase family protein (Serratia liquefaciens MT49)
MSKIMDLTALATQLDQATLSQQATAQLTGQQALDLPTAYRIQAEGIRLREQRGERRVGLK
LGFTSRAKMQQMGVDHLIWGELTDAMQIEEGGTLDLRELIHPRVEPELCFITGQEINGPL
SLAEAGRVLEGVCPALEIIDSRYRDFRFTLEDVIADNCSSAKFVVGALQNPQRAIDNLGV
VMNFHGRPVQVGSTAAILGHPLRALVQIASLLHQQERVLPAGSVILAGAATAAEALRPGL
HVSVDISGFGRTAFHTEGQL